PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00006278-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 193aa    MW: 22009.9 Da    PI: 9.642
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00006278-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.5e-213293157
                        TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        ++ R+++t+eq+++L +lF++  r+ps++++++++++l    +++ ++V++WFqN++a+e++
  WALNUT_00006278-RA 32 KCGRWNPTSEQVKVLTDLFRSgLRTPSTDQIQKISTQLsfygKIESKNVFYWFQNHKARERQ 93
                        568*****************99**************************************97 PP

2Wus_type_Homeobox114.36.2e-373295265
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        ++ RW+Pt+eQ+k+L++l++sGlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
  WALNUT_00006278-RA 32 KCGRWNPTSEQVKVLTDLFRSGLRTPSTDQIQKISTQLSFYGKIESKNVFYWFQNHKARERQKR 95
                        678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.9322994IPR001356Homeobox domain
SMARTSM003894.0E-43198IPR001356Homeobox domain
PfamPF000465.8E-183393IPR001356Homeobox domain
SuperFamilySSF466898.98E-123496IPR009057Homeodomain-like
CDDcd000863.17E-43595No hitNo description
Gene3DG3DSA:1.10.10.602.6E-83593IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MEEAGMSAFC LKAGSVRGGG GGGGNGSTTG TKCGRWNPTS EQVKVLTDLF RSGLRTPSTD  60
QIQKISTQLS FYGKIESKNV FYWFQNHKAR ERQKRRRVSC IDEKDLILQD EKISSVKRTF  120
KHLGIRNFTD MNRYSEPERS VIETLQLFPL NSFDPESEKL RLHANDYKEI TGFSYKIGTE  180
MEHSPLDLRL SFL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19397KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009344529.11e-82PREDICTED: WUSCHEL-related homeobox 7
SwissprotQ8H1D21e-58WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLM5XSQ73e-81M5XSQ7_PRUPE; Uncharacterized protein
TrEMBLA0A067FNU93e-81A0A067FNU9_CITSI; Uncharacterized protein
STRINGPOPTR_0010s19950.13e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60143452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.17e-54WUSCHEL related homeobox 5